Old 10th August 2004, 16:39   #1
Pixelcraft
Wildly Confused
(Major Dude)
 
Pixelcraft's Avatar
 
Join Date: Jan 2003
Location: Minnesota
Posts: 1,204
Fucking Austria

http://www.snopes.com/photos/austria.asp


"It's like saying give a man a Les Paul guitar and he becomes Eric Clapton, and of course that's not true, give a man an amplifier and a synthesizer and he doesn't become...whoever; he doesn't become us." - Roger Waters
Pixelcraft is offline   Reply With Quote
Old 10th August 2004, 18:41   #2
eleet-2k2
Forum King
 
eleet-2k2's Avatar
 
Join Date: Aug 2001
Location: Mobil Ave.
Posts: 5,381
Sweet town! I especially love the sign on the second picture.

"Welcome to the Island of people who know too much."..."Did you really think balloons would stop him?!"
See what I'm listening too.
eleet-2k2 is offline   Reply With Quote
Old 10th August 2004, 19:19   #3
Smeggle
Just Strolling By
(Major Dude)
 
Smeggle's Avatar
 
Join Date: Aug 2002
Location: A Long Winding Road.....
Posts: 3,250
ah hahahahahahahahahahahahahahahahahahah LMAO

I agree the second sign

Music is Life, Love and Happiness :|: Life is Music. Serren - 1985 - 2005
Religion? Religion is a Blasphemy against humanity - From the film What the Bleep do we know

siggy link So stumbling? whats it all about
Smeggle is offline   Reply With Quote
Old 10th August 2004, 19:55   #4
CaptainNuss
Indecisive One
(Senior Member)
 
CaptainNuss's Avatar
 
Join Date: Jul 2004
Location: :morF
Posts: 625
Hilarious!

[size=1]"Programming today is a race between software engineers striving to build bigger and better idiot-proof programs and the universe trying to produce bigger and better idiots. So far, the universe is winning." - Richard Cook
CaptainNuss is offline   Reply With Quote
Old 10th August 2004, 22:17   #5
Bilbo Baggins
Wind Chime of the Apocalypse
 
Bilbo Baggins's Avatar
 
Join Date: May 2000
Location: The Forest
Posts: 17,229
Old hat.
Bilbo Baggins is offline   Reply With Quote
Old 10th August 2004, 22:40   #6
CaptainNuss
Indecisive One
(Senior Member)
 
CaptainNuss's Avatar
 
Join Date: Jul 2004
Location: :morF
Posts: 625
Hilarious old hat.

[size=1]"Programming today is a race between software engineers striving to build bigger and better idiot-proof programs and the universe trying to produce bigger and better idiots. So far, the universe is winning." - Richard Cook
CaptainNuss is offline   Reply With Quote
Old 11th August 2004, 01:37   #7
griffinn
Court Jester
(Forum King)
 
griffinn's Avatar
 
Join Date: May 2000
Location: Your local toystore
Posts: 3,501
Send a message via ICQ to griffinn
Long Dong (Guangxi, China)
Mount Titlis (Switzerland)
Blowhard (Australia)
Sexbierum (Netherlands)
Reamstown (Pennsylvania, USA)
Pecker's Point (Newfoundland, Canada)
Lickdale (Pennsylvania)
Pickles Gap (Arkansas)
Nether Wallop (England)
Petting (Germany)
Mount Mee (Australia)
Titting (Germany)
Titty Ho (England)
Lickdale (Pennsylvania, USA)
Yocumtown (Pennsylvania, USA)
Fugit (Kentucky, USA)
Assinippi (Massachusetts, USA)
Big Cockup and Little Cockup (England)
Cocktown (Wexford, Ireland)
Sally's Gap (Ireland)
Dick Johnson (Indiana, USA)
Beaver Bottom (Kentucky, USA)
Black Butte (Oregon, USA)
Sandy Balls (England)
Tilicum (Washington, USA)
Cockburn (Australia)
Bangor (Wales)
Dyckesville (Wisconsin, USA)
Ballville (Ohio, USA)
Prickwillow (England)
Black Charlie's Opening (Australia)
Kinmount (Ontario, Canada)
Euren (Wisconsin, USA)
Cockland (Ohio, USA)
Spuzzum (Canada)
Bloody Dick (Montana, USA)
Shafter (California, USA)
Beaver (Oklahoma, USA)
Mt. Buggery (Australia)
Handcock Town (North Carolina, USA)
Shitlingthorpe (Yorkshire, UK)
Sackville (Canada)
Twatt (Orkney, UK)
Muff (County Donegal, Ireland)
Licking Valley (Ohio, USA)
Gobblers Knob (Kentucky, USA)
Wankie (Zimbabwe)
Nobber (Donegal, Ireland)
Lickey End (West Midlands, UK)
Fukum (Yemen)
Lord Berkeley's Knob (Sutherland, Scotland)
Dildo (Newfoundland, Canada)
Turdo (Romania)
Dongo (Congo, Democratic Republic)
Seymen (Turkey)
Dong Rack (Thailand-Cambodia border)
Intercourse (Pennsylvania, USA)
Brown Willy (Cornwall,UK)
Wanks River (Nicaragua)
Wankie Colliery (Zimbabwe)
Chinaman's Knob (Australia)
Wet Beaver Creek (Australia)
Tittybong (Australia)
Pis Pis River (Nicaragua)
Dikshit (India)
Wankener (India)
Sexmoan (Luzon, Philippines)
Elephant Butte (New Mexico, USA)
Maggie's Nipples (Wyoming, USA)
Bone's Knob (Queensland, Australia)
Fingeringhoe (Essex, UK)
Titz (Germany)
Needmore (Texas, USA)
Fruitport (Michigan, USA)
Zip Down (Pennsylvania, USA)
Mount Holly (New Jersey, USA)
Hookersville (West Virginia, USA)
Penistone (South Yorkshire, UK)
Slackbottom (Yorkshire, UK)
Likwang (China)
Climax Springs (Missouri, USA)
Butt's Corner (New York, USA)
Cocksgag (Ohio, USA)
Hardup (Utah, USA)
Top Ryde (New South Wales, Australia)
Tingley (Iowa, USA)
Lay (Colorado, USA)
Wankendorf (Schleswig-Holstein, Germany)
Fuku (Shensi, China)
Beaver Head (Idaho, USA)
Fukui (Honshu, Japan)
Shag Island (Indian Ocean)
Fukue (Honshu, Japan)
Middle Intercourse Island (Australia)
Lick Run (Pennsylvania, USA)
Humptulips (Washington, USA)
Onenut (California, USA)
Stains (France)
Naked City (Indiana, USA)
Cocke County (Tennessee, USA)
Bonar Bridge (Scotland)
Weiner (Alabama, USA)
Bear Butte (South Dakota, USA)
Flasher (North Dakota, USA)
Penisthorpe (England)
Felch (Michigan, USA)
Athol (Scotland)
Beaver Island (Michigan, USA)
Knob Lick (Kentucky, USA)
River Koksoak (Canada)
Bumpass Creek (Alabama, USA)
Smackass Gap (North Carolina, USA)
Horton Cum Studley (Oxfordshire, England)
Beaver Cove (Maine, USA)
Fanny Bay (Australia)
Erect (North Carolina, USA)
Bastardstown (County Wexford, Ireland)
Assonet (Massachusetts, USA)
Stillorgan (Ireland)
Wattanobby (Australia)
Devil's Dyke (United Kingdom)
Peniscola (Spain)
Brest (France)
Headland (Alabama, USA)
Wetwang (North Yorkshire, UK)
Dykehead (Scotland)
Six Mile Bottom (Newmarket, UK)
Licking (Missouri, USA)
Gnaw Bone (Indiana, USA)
Four Buttes (Montana, USA)
Manley Hot Springs (Alaska, USA)
Organ (New Mexico, USA)
Moorhead (Mississippi, USA)
Butte City (Idaho, USA)
Fertile (Iowa, USA)
Smuts (Saskatchewan, Canada)
Hooker (Oklahoma, USA)
Fairy Glen (Saskatchewan, Canada)
Gaylordsville (Connecticut, USA)
Kisslegg (Bavaria, Germany)
Wangen (Bavaria, Germany)
Titisee (Freiburg, Germany)
Gassville (Arkansas, USA)
Frenchman Butte (Saskatchewan, Canada)
Smackover (Arkansas, USA)
Upper Piddle, Lower Piddle (Worcestershire, England)
Packwood (Iowa, USA)
Ramsbottom (Lancashire, England)
Flushdyke (Yorkshire, England)
Fruitville (Florida, USA)
Bitche (France)
Gay Head (Massachusetts, USA)
Beaver Lick, Knob Lick, Red Bush, Gays Creek, Fisty, Dykes, Breeding (Kentucky, USA)
Belchertown (Massachusetts, USA)
Tit-Ary (Siberia)
Bra (Italy)
Assen and Dikanas (Sweden)
Beaver City and Floyd's Knobs (Indiana, USA)
Frazier's Bottom (West Virginia, USA)
Alison's Gap, Bumpass and Ballsville (Virginia, USA)
Knockemstiff and Round Bottom (Ohio, USA)
Colon and Cumnock (North Carolina, USA)
Kickapoo, Red Dick and Pink Staff (Illinois, USA)
Butts (Georgia, USA)
Nutbush, Love Lady and Big Lick (Tennessee, USA)
Gay (Oklahoma, USA)
Tightwad (Missouri, USA)
Blue Ball and Bald Knob (Arkansas, USA)
Phuket (Thailand)
Condom (France)
Buttzville (New Jersey, USA)
Spread Eagle (Newfoundland)
Intercourse (Pennsylvania, USA)
Puseyville (Pennsylvania, USA)
Blue Ball (Pennsylvania, USA)
Big Beaver (Saskatchewan, Canada)
Athol (Idaho, USA)
Wanker's Corner (Oregon, USA)
Mianus (Connecticut, USA)
Fucu (Mozambique)
Sac City (Iowa, USA)
Slut (Vasterbotten, Sweden)
Crappo (Maryland, USA)
Busti (New York, USA)
Gaysport (Ohio, USA)
Jugtown (Pennsylvania, USA)
Ass Rock (Newfoundland, Canada)
Study Butte (Texas, USA)
Dorking (Surrey, Great Britain)
Wank (Bavaria)
Ass Hill (Newfoundland, Canada)
Blow Me Down (Newfoundland, Canada)
Old Man's Head (Newfoundland, Canada)
Meat Cove (Nova Scotia, Canada)
Shitagoo Lake (Quebec, Canada)
Smuts (Saskatchewan, Canada)
Boob Creek (Alaska, USA)
Gayville and Fruitdale (South Dakota, USA)
Tatitlik (Alaska, USA)
Bald Knob (Illinois, USA)
Fertile (Minnesota, USA)
Horneytown (North Carolina, USA)
Meat Camp (North Carolina, USA)
French Lick (Indiana, USA)
Reddick (Florida, USA)
Virginville (Pennsylvania, USA)
Conception Bay (Newfoundland)
Yorky's Knob (Queensland, Australia)
Crested Butte (Colorado, USA)
Big Ugly (West Virginia, USA)
Piddle-in-the-Hole (England)
Blueball (Pennsylvania, USA)
Shag Harbour (Nova Scotia)
Come by Chance (Newfoundland)
Dick Knob (Australia)
Toad Suck (Arkansas, USA)
Pussy Creak (Ireland)
Kiester (Minnesota, USA)
Weed (New Mexico, USA)
Dryknob (Missouri, USA)
Myanis (New York, USA)
Smackey Bottom (Kentucky, USA)
Bastard Township (Leeds County, Canada)
Mount Scott (Oklahoma, USA)
Fucking (Austria)
Belcher (Louisana, USA)
Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch (North Wales, U.K.)

Breedsville (Michigan, USA)
Cumming (Georgia, USA)
Beaver Crossing (Nebraska, USA)
Boring (Oregon, USA)
Hell (Indiana, USA)
Fruitland (Idaho,USA)
Cherry Valley, Beaver Dams, Climax, Coxsackie (New York, USA)
Fort Gay (West Virginia, USA)
Conception Junction (Missouri, USA)
Sexsmith (Alberta, Canada)
Middlesex (New Jersey, USA)
Gays Mills (Wisconsin, USA)
Cummington (Massachusetts, USA)
Upper Dicker, Lower Dicker (East Sussex, U.K.)
Cockermouth (Lake District, U.K.)
Dix (Illinois, USA)
Cockeysville (Maryland, USA)
Dykesville (Wisconsin, USA)
Beaverton (Oregon, USA)
Bareneed (Newfoundland, Canada)
Bumbang (Victoria, Australia)
Sugar Tit (South Carolina, USA)
Knudshoved (Denmark)
Licky Hills (England)
Needmore (Alabama, USA)
Crapo (Maryland, USA)
Bogue Homo (Mississippi, USA)
Buttzville (New Jersey, USA)
Lovelady (Texas, USA)
Ding Dong (Texas, USA)
Assawoman (Virginia, USA)
Lizard Lick (North Carolina, USA)
Dildo Run Provincial Park (Newfoundland, Canada)
Virgin Arm (Newfoundland, Canada)
Mink Cove (Novia Scotia, Canada)
Cankerville (Ontario, Canada)
Crotch Lake (Ontario, Canada)
Nipissing (Ontario, Canada)
Flower Mound (Texas, USA)
Dyke (Kentucky, USA)
Morehead (Kentucky, USA)
Pusey (Gluoster, United Kingdom)
Acocks Green (Birmingham, United Kingdom)
Tunapuna (Trinidad)

The smiley slot machine! | Quotable Blog
griffinn is offline   Reply With Quote
Old 11th August 2004, 05:02   #8
Pixelcraft
Wildly Confused
(Major Dude)
 
Pixelcraft's Avatar
 
Join Date: Jan 2003
Location: Minnesota
Posts: 1,204
Quote:
Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch
How drunk do you have to be to be able to say that?

"It's like saying give a man a Les Paul guitar and he becomes Eric Clapton, and of course that's not true, give a man an amplifier and a synthesizer and he doesn't become...whoever; he doesn't become us." - Roger Waters
Pixelcraft is offline   Reply With Quote
Old 11th August 2004, 05:53   #9
horse-fly
Account Closed
 
horse-fly's Avatar
 
Join Date: Apr 2001
Posts: 2,360
Quote:
Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch
Did Michael J Fox write up that sign?
horse-fly is offline   Reply With Quote
Old 11th August 2004, 05:58   #10
shakey_snake
Forum Domo
 
shakey_snake's Avatar
 
Join Date: Jan 2004
Location: Everyone, get over here for the picture!
Posts: 4,313
quote: Fucking Austria
Austria? You're kidding.
Well, g'day, mate. What do you say
we get together later and throw a few shrimp on the barbie.

Lets not.

Guess I won't be going Down Under
tonight…


elevatorladyelevatorladyelevatorladyelevatorladyelevatorladylevitateme
shakey_snake is offline   Reply With Quote
Old 11th August 2004, 07:19   #11
griffinn
Court Jester
(Forum King)
 
griffinn's Avatar
 
Join Date: May 2000
Location: Your local toystore
Posts: 3,501
Send a message via ICQ to griffinn
The surefire way to piss off an Austrian is to ask whether he's an Australian.

The smiley slot machine! | Quotable Blog
griffinn is offline   Reply With Quote
Old 11th August 2004, 07:48   #12
shakey_snake
Forum Domo
 
shakey_snake's Avatar
 
Join Date: Jan 2004
Location: Everyone, get over here for the picture!
Posts: 4,313
referance


elevatorladyelevatorladyelevatorladyelevatorladyelevatorladylevitateme
shakey_snake is offline   Reply With Quote
Old 11th August 2004, 08:04   #13
GqSkrub
Major Dude
 
GqSkrub's Avatar
 
Join Date: Jun 2003
Location: Lancaster Pennsylvania
Posts: 897
Send a message via AIM to GqSkrub
There is a station in Wales called Gorsafawddachaidraigodanheddogleddollonpenrhynareurdraethceredigion but this is well less known.

And finally, sadly even the 67 character allowance for a .com domain name is still insufficient for the town of Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu
in New Zealand with a staggering 92 characters however even this seems positively tiny compared to the town of

Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit

in Thailand which is a whopping 163 characters long so long that it doesn't even fit on one line! However whilst the New Zealand place name is recognised by the Guiness Book of Record, the Thailand name is not.

No sig here folks.
GqSkrub is offline   Reply With Quote
Old 11th August 2004, 10:39   #14
Cognition
Some Random Guy
(Major Dude)
 
Cognition's Avatar
 
Join Date: Mar 2003
Location: NZ
Posts: 1,244
There is so not a place in NZ called that. That's Maori (native language) but there is no word that long, I'm almost positive, even if it's made up of heaps of different words. And I certainly haven't seen it on a map, so if it exists it's a tiny nothing place, not a proper town.

[EDIT]
Okay, I looked it up:
Quote:
the word is actually Maori in origin and is the placename of a 305m hill, near Mangaorapa and close to Porangahau, south of Waipukurau, between Hastings and Dannevirke, in southern Hawkes Bay, New Zealand. The placename is often shortened to Taumata by the locals for ease of conversation.

It translates roughly into English as "The brow of the hill, where Tamatea, the man with the big knees, who slid down, climbed up and swallowed mountains, to travel the land, who is known as the Land Eater, played on his nose flute to his loved one."
So okay, I concede, but as I assumed, it's not a town, it's a hill. Plus yeah, it's just made up of lots of different words, so it's basically just a sentence. But still, yeah, that's long.
[/EDIT]
Cognition is offline   Reply With Quote
Old 11th August 2004, 18:54   #15
ertmann|CPH
Forum Viking
(Forum King)
 
ertmann|CPH's Avatar
 
Join Date: Jan 2001
Location: The North
Posts: 3,541
he, english speakers allways have a laugh when they drive through Middelfart over here

they also think this childs candy is rather funny
ertmann|CPH is offline   Reply With Quote
Old 11th August 2004, 19:22   #16
MonKeyRum
Major Dude
 
MonKeyRum's Avatar
 
Join Date: May 2004
Location: The North
Posts: 859
damn resisting urge to make a joke about getting spunk in your mouth...

Suburbia: The place where they clear down trees and then name roads after them
MonKeyRum is offline   Reply With Quote
Old 11th August 2004, 19:40   #17
ertmann|CPH
Forum Viking
(Forum King)
 
ertmann|CPH's Avatar
 
Join Date: Jan 2001
Location: The North
Posts: 3,541
hahaha, then read the history behind the name at the producers website

http://www.gallejessen.com/article.asp?id=1162

ROFL!
ertmann|CPH is offline   Reply With Quote
Reply
Go Back   Winamp & Shoutcast Forums > Community Center > General Discussions

Thread Tools Search this Thread
Search this Thread:

Advanced Search
Display Modes

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

BB code is On
Smilies are On
[IMG] code is On
HTML code is Off

Forum Jump